PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID MELO3C014103P1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
Family NF-YB
Protein Properties Length: 154aa    MW: 16424.2 Da    PI: 5.0196
Description NF-YB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
MELO3C014103P1genomeMELONOMICSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NF-YB179.72.6e-5619114297
           NF-YB   2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 
                     re+dr+lPianv+rimkk+lP+nakiskdaketvqecvsefisfvt+easdkc++ekrktingddllwa+atlGfedyv+plk+yl+++re+ege
  MELO3C014103P1  19 REHDRLLPIANVGRIMKKALPGNAKISKDAKETVQECVSEFISFVTGEASDKCHNEKRKTINGDDLLWAMATLGFEDYVDPLKLYLQRFREIEGE 113
                     799*******************************************************************************************9 PP

           NF-YB  97 k 97 
                     +
  MELO3C014103P1 114 R 114
                     7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.20.109.7E-5214123IPR009072Histone-fold
SuperFamilySSF471136.99E-4022133IPR009072Histone-fold
PfamPF008085.4E-282488IPR003958Transcription factor CBF/NF-Y/archaeal histone domain
PRINTSPR006151.6E-205270No hitNo description
PROSITE patternPS0068505571IPR003956Transcription factor, NFYB/HAP3, conserved site
PRINTSPR006151.6E-207189No hitNo description
PRINTSPR006151.6E-2090108No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046982Molecular Functionprotein heterodimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 154 aa     Download sequence    Send to blast
MADSDNDSGG GYQKSPSPRE HDRLLPIANV GRIMKKALPG NAKISKDAKE TVQECVSEFI  60
SFVTGEASDK CHNEKRKTIN GDDLLWAMAT LGFEDYVDPL KLYLQRFREI EGERTTLASR  120
DSAASSAPNS AAAGNSGFFD GGGEFGGGMK GWG*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_B3e-4817109294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
4csr_A3e-4817109294NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT BETA
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankLN6818600.0LN681860.1 Cucumis melo genomic scaffold, anchoredscaffold00021.
GenBankLN7132600.0LN713260.1 Cucumis melo genomic chromosome, chr_6.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008449032.11e-106PREDICTED: nuclear transcription factor Y subunit B-3-like
SwissprotO233102e-67NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBLA0A0A0L4U43e-85A0A0A0L4U4_CUCSA; Uncharacterized protein
STRINGPOPTR_0001s37620.13e-67(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF59134150
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14540.14e-67nuclear factor Y, subunit B3